Name | OR2L2 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA337491 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
Antigen | The immunogen for Anti-OR2L2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2L2. Synthetic peptide located within the following region: HLTVVSFYYAPFAYTYVRPRSLRSPTEDKILAVFYTILTPMLNPIIYSLR. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | OR2L2 |
Supplier Page | Shop |