OR2T12 antibody
| Name | OR2T12 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337496 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-OR2T12 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2T12. Synthetic peptide located within the following region: VVSAFYTMFTPLLNPLIYSVRNSEVKEALKRWLGTCVNLKHQQNEAHRSR. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | OR2T12 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: OR2T12; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml