OR5K4 antibody
| Name | OR5K4 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337532 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human, Pig, Rat |
| Antigen | The immunogen for Anti-OR5K4 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5K4. Synthetic peptide located within the following region: FLSVSIFYICLLMYIGPSEEGDKDTPVAIFYAIVIPLLNPFIYSLRNKEV. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | OR5K4 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: OR5K4; Sample Tissue: NCI-H226 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml