OR6C1 antibody
| Name | OR6C1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334899 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Pig, Rabbit |
| Antigen | The immunogen for anti-OR6C1 antibody is synthetic peptide directed towards the C-terminal region of Human OR6C1. Synthetic peptide located within the following region: PSTSQRTKAFSTCSSHMVVVSISYGSCIFMYIKPSAKDRVSLSKGVAILN. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | OR6C1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: OR6C1; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/ml