OR8U8 antibody
| Name | OR8U8 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332264 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-OR8U8 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR8U8. Synthetic peptide located within the following region: SLDADKMASVFYTVIIPMLNPLIYSLRNKDVKDALKKVIINRNHAFIFLK. |
| Description | Rabbit Polyclonal |
| Gene | OR8U8 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: OR8U8; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml