OR51V1 antibody
| Name | OR51V1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332305 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-OR51V1 Antibody is: synthetic peptide directed towards the N-terminal region of Human OR51V1. Synthetic peptide located within the following region: MFLSSRMITSVSPSTSTNSSFLLTGFSGMEQQYPWLSIPFSSIYAMVLLG. |
| Description | Rabbit Polyclonal |
| Gene | OR51V1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: OR51V1; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0ug/ml