OR52I2 antibody
| Name | OR52I2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332298 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-OR52I2 Antibody is: synthetic peptide directed towards the N-terminal region of Human OR52I2. Synthetic peptide located within the following region: SSVVPKMVSIFCSGDSSISFSACFTQMFFVHLATAVETGLLLTMAFDRYV. |
| Description | Rabbit Polyclonal |
| Gene | OR52I2 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: OR52I2; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml