Name | OST4 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA338306 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Dog, Human, Mouse, Rat, Zebrafish |
Antigen | The immunogen for anti-OST4 antibody is: synthetic peptide directed towards the C-terminal region of Human OST4. Synthetic peptide located within the following region: MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | OST4 |
Supplier Page | Shop |