Otospiralin antibody
| Name | Otospiralin antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338813 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Pig, Rat |
| Antigen | The immunogen for anti-OTOS antibody: synthetic peptide directed towards the N terminal of human OTOS. Synthetic peptide located within the following region: MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | OTOS |
| Supplier Page | Shop |
Product images
WB Suggested Anti-OTOS Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate