OTUD1 antibody
| Name | OTUD1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332176 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Rat |
| Antigen | The immunogen for Anti-OTUD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OTUD1. Synthetic peptide located within the following region: NGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSMAISLSKMYIEQN. |
| Description | Rabbit Polyclonal |
| Gene | OTUD1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: OTUD1; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml