Papilin / PAPLN antibody
| Name | Papilin / PAPLN antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331345 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Pig, Rat |
| Antigen | The immunogen for Anti-PAPLN antibody is: synthetic peptide directed towards the C-terminal region of Human PAPLN. Synthetic peptide located within the following region: YQGSQAVSRSTEVKVVSPAPTAQPRDPGRDCVDQPELANCDLILQAQLCG. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | PAPLN |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: PAPLN; Sample Tissue: PANC1 Whole Cell lysates; Antibody Dilution: 1.0ug/ml