Papilin / PAPLN antibody
| Name | Papilin / PAPLN antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331346 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Human, Pig, Rabbit |
| Antigen | The immunogen for Anti-PAPLN antibody is: synthetic peptide directed towards the C-terminal region of Human PAPLN. Synthetic peptide located within the following region: QPISSDRHRLQFDGSLIIHPLQAEDAGTYSCGSTRPGRDSQKIQLRIIGG. |
| Description | Rabbit Polyclonal |
| Gene | PAPLN |
| Supplier Page | Shop |
Product images
WB Suggested Anti-PAPLN Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell