PATE4 antibody
| Name | PATE4 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332181 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-PATE4 Antibody is: synthetic peptide directed towards the middle region of Human PATE4. Synthetic peptide located within the following region: KENELCSTTAYFRGDKHMYSTHMCKYKCREEESSKRGLLRVTLCCDRNFC. |
| Description | Rabbit Polyclonal |
| Gene | PATE4 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: PATE4; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml