PDLIM1 antibody
| Name | PDLIM1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342321 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat |
| Antigen | The immunogen for anti-PDLIM1 antibody: synthetic peptide directed towards the middle region of mouse PDLIM1. Synthetic peptide located within the following region: TSASGEEANSRPVVQPHPSGSLIIDKDSEVYKMLQEKQELNEPPKQSTSF. |
| Description | Rabbit Polyclonal |
| Gene | Pdlim1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-PDLIM1 Antibody Titration: 0.625 ug/ml; ELISA Titer: 1:1562500; Positive Control: NIH/3T3 cell lysate