Name | PDLIM1 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA342321 |
Prices | $325.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Mouse, Rat |
Antigen | The immunogen for anti-PDLIM1 antibody: synthetic peptide directed towards the middle region of mouse PDLIM1. Synthetic peptide located within the following region: TSASGEEANSRPVVQPHPSGSLIIDKDSEVYKMLQEKQELNEPPKQSTSF. |
Description | Rabbit Polyclonal |
Gene | Pdlim1 |
Supplier Page | Shop |