PGPEP1L antibody
| Name | PGPEP1L antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332200 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-PGPEP1L Antibody is: synthetic peptide directed towards the N-terminal region of Human PGPEP1L. Synthetic peptide located within the following region: GMDTAAKAIILEQSGKNQGYRDADIRSFWPEGGVCLPGSPDVLESGVCMK. |
| Description | Rabbit Polyclonal |
| Gene | PGPEP1L |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: PGPEP1L; Sample Tissue: COLO205 Whole Cell lysates; Antibody Dilution: 1.0ug/ml