| Name | PHYHIPL antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342760 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-PHYHIPL antibody: synthetic peptide directed towards the C terminal of human PHYHIPL. Synthetic peptide located within the following region: QDVILEVIYTDPVDLSVGTVAEITGHQLMSLSTANAKKDPSCKTCNISVG. |
| Description | Rabbit Polyclonal |
| Gene | PHYHIPL |
| Supplier Page | Shop |