PIGS antibody
| Name | PIGS antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342053 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-Pigs antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVAAVQKAAKALALGHLSSAFAASQEAVTSSERAFFDPSLLHLLYFPDDQ. |
| Description | Rabbit Polyclonal |
| Gene | Pigs |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Pigs Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Small Intestine