PKDREJ antibody

Name PKDREJ antibody
Supplier Acris Antibodies
Catalog TA338560
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for anti-PKDREJ antibody: synthetic peptide directed towards the middle region of human PKDREJ. Synthetic peptide located within the following region: GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEVDGSLKKTTGG.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene PKDREJ
Supplier Page Shop

Product images