PLA2G2C antibody
| Name | PLA2G2C antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334348 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-PLA2G2C antibody is: synthetic peptide directed towards the middle region of Human PLA2G2C. Synthetic peptide located within the following region: LGDKGIPVDDTDSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | PLA2G2C |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: PLA2G2C; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml