PLAC1L antibody
| Name | PLAC1L antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342545 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Human, Rat |
| Antigen | The immunogen for anti-PLAC1L antibody: synthetic peptide directed towards the middle region of human PLAC1L. Synthetic peptide located within the following region: YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW. |
| Description | Rabbit Polyclonal |
| Gene | OOSP2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-PLAC1L Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate