PLET1 antibody
| Name | PLET1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332179 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-C11orf34 Antibody is: synthetic peptide directed towards the middle region of Human C11orf34. Synthetic peptide located within the following region: NSDSAGLWQRADKNCYSNSTYYVKDQYMTVLEAQWQAPEPENITEVEIQA. |
| Description | Rabbit Polyclonal |
| Gene | PLET1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C11orf34; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml