PNMA6A antibody
| Name | PNMA6A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA343035 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human |
| Antigen | The immunogen for anti-PNMA6A antibody: synthetic peptide directed towards the N terminal of human PNMA6A. Synthetic peptide located within the following region: FTVLGKVFREEDNATAALVELDREVNYALVPREIPGTGGPWNVVFVPRCS. |
| Description | Rabbit Polyclonal |
| Gene | PNMA6A |
| Supplier Page | Shop |
Product images
WB Suggested Anti-PNMA6A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Lung