PPFIA4 antibody
| Name | PPFIA4 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331286 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-PPFIA4 antibody is: synthetic peptide directed towards the N-terminal region of Human PPFIA4. Synthetic peptide located within the following region: AQDLDRMGVMTLPSDLRKHRRKLLSPVSREENREDKATIKCETSPPSSPR. |
| Description | Rabbit Polyclonal |
| Gene | PPFIA4 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-PPFIA4 Antibody; Titration: 1.0 ug/ml; Positive Control: RPMI-8226 Whole Cell