PRAMEF11 antibody
| Name | PRAMEF11 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330884 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-PRAMEF11 antibody is: synthetic peptide directed towards the middle region of Human PRAMEF11. Synthetic peptide located within the following region: TQFTPYLGHLRNLQKLVLSHMDVSRYVSPEQKKEIVTQFTTQFLKLRCLQ. |
| Description | Rabbit Polyclonal |
| Gene | PRAMEF11 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: PRAMEF11; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0ug/ml