PRAMEF19 antibody
| Name | PRAMEF19 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330885 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-PRAMEF19 antibody is: synthetic peptide directed towards the N-terminal region of Human PRAMEF19. Synthetic peptide located within the following region: EKQPLKVFMDVCLKEKSVDEDLSFFSGWVQHRRRSVHLCCTKVVNYSMNI. |
| Description | Rabbit Polyclonal |
| Gene | PRAMEF19 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: PRAMEF19; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml