PRELID2 antibody
| Name | PRELID2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337600 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for anti-PRELID2 antibody: synthetic peptide directed towards the C terminal of human PRELID2. Synthetic peptide located within the following region: GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | PRELID2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-PRELID2 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate