PRSS37 / TRYX2 antibody
| Name | PRSS37 / TRYX2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332279 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-PRSS37 Antibody is: synthetic peptide directed towards the N-terminal region of Human PRSS37. Synthetic peptide located within the following region: AGTFFFADSSVQKEDPAPYLVYLKSHFNPCVGVLIKPSWVLAPAHCYLPN. |
| Description | Rabbit Polyclonal |
| Gene | PRSS37 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: PRSS37; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml