PRSS38 antibody
| Name | PRSS38 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331537 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-PRSS38 Antibody is: synthetic peptide directed towards the C-terminal region of Human PRSS38. Synthetic peptide located within the following region: SESVLPVCLATPEVNLTSANCWATGWGLVSKQGETSDELQEMQLPLILEP. |
| Description | Rabbit Polyclonal |
| Gene | PRSS38 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: PRSS38; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0ug/ml