PTCD1 antibody
| Name | PTCD1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331946 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-PTCD1 Antibody is: synthetic peptide directed towards the N-terminal region of Human PTCD1. Synthetic peptide located within the following region: SQLPLGQERQENTGSLGSDPSHSNSTATQEEDEEEEESFGTLSDKYSSRR. |
| Description | Rabbit Polyclonal |
| Gene | PTCD1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: PTCD1; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml