PUS7L antibody

Name PUS7L antibody
Supplier Acris Antibodies
Catalog TA331702
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-PUS7L Antibody is: synthetic peptide directed towards the N-terminal region of Human PUS7L. Synthetic peptide located within the following region: QSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNFACDVREKWLSK.
Description Rabbit Polyclonal
Gene PUS7L
Supplier Page Shop

Product images