PUS7L antibody
| Name | PUS7L antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331702 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-PUS7L Antibody is: synthetic peptide directed towards the N-terminal region of Human PUS7L. Synthetic peptide located within the following region: QSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNFACDVREKWLSK. |
| Description | Rabbit Polyclonal |
| Gene | PUS7L |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: PUS7L; Sample Tissue: HepG2 Whole cell lysates; Antibody Dilution: 1.0ug/ml