RAD9B antibody
| Name | RAD9B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338848 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Human, Pig, Rabbit |
| Antigen | The immunogen for Anti-RAD9B antibody is: synthetic peptide directed towards the C-terminal region of Human RAD9B. Synthetic peptide located within the following region: ATHAPISIYFDFPGKPLALSIDDMLVEANFILATLADEQSRASSPQSLCL. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | RAD9B |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: RAD9B; Sample Tissue: Fetal Thymus lysates; Antibody Dilution: 1.0 ug/ml