RALGPS2 antibody
| Name | RALGPS2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA344942 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Mouse, Rabbit, Rat |
| Antigen | The immunogen for anti-RALGPS2 antibody: synthetic peptide directed towards the n terminal of human RALGPS2. Synthetic peptide located within the following region: MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | Ralgps2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-RALGPS2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate