REP15 antibody
| Name | REP15 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331354 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-REP15 antibody is: synthetic peptide directed towards the N-terminal region of Human REP15. Synthetic peptide located within the following region: YPPSKLCPAANTLNEIFLIHFITFCQEKGVDEWLTTTKMTKHQAFLFGAD. |
| Description | Rabbit Polyclonal |
| Gene | REP15 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-REP15 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Kidney