RFX8 antibody

Name RFX8 antibody
Supplier Acris Antibodies
Catalog TA330886
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-RFX8 antibody is: synthetic peptide directed towards the C-terminal region of Human RFX8. Synthetic peptide located within the following region: AIINQGTLATSKKALASDRSGADELENNPEMKCLRNLISLLGTSTDLRVF.
Description Rabbit Polyclonal
Gene RFX8
Supplier Page Shop

Product images