RIPPLY1 antibody
| Name | RIPPLY1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333545 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Human, Rat |
| Antigen | The immunogen for Anti-RIPPLY1 Antibody is: synthetic peptide directed towards the middle region of Human RIPPLY1. Synthetic peptide located within the following region: RPWLSSTNDSPRQMRKLVDLAAGGATAAEVTKAESKFHHPVRLFWPKSRS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | RIPPLY1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: RIPPLY1; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0 ug/ml