RNPEPL1 antibody
| Name | RNPEPL1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA344900 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Guinea Pig, Mouse, Pig |
| Antigen | The immunogen for anti-RNPEPL1 antibody: synthetic peptide directed towards the N terminal of human RNPEPL1. Synthetic peptide located within the following region: LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | RNPEPL1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-RNPEPL1 Antibody Titration: 0.2-1 ug/ml; Positive Control: THP-1 cell lysate