RRP12 antibody
| Name | RRP12 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333837 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-RRP12 Antibody is: synthetic peptide directed towards the C-terminal region of Human RRP12. Synthetic peptide located within the following region: AQRVLATQPGPGRGRKKDHGFKVSADGRLIIREEADGNKMEEEEGAKGED. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | RRP12 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-RRP12 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole CellRRP12 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells