RSPH6A / RSHL1 antibody

Name RSPH6A / RSHL1 antibody
Supplier Acris Antibodies
Catalog TA331711
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Rat
Antigen The immunogen for Anti-RSPH6A Antibody is: synthetic peptide directed towards the C-terminal region of Human RSPH6A. Synthetic peptide located within the following region: MANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEV.
Description Rabbit Polyclonal
Gene RSPH6A
Supplier Page Shop

Product images