RSPH10B2 antibody
| Name | RSPH10B2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335121 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Human, Mouse |
| Antigen | The immunogen for anti-RSPH10B antibody: synthetic peptide directed towards the middle region of human RSPH10B. Synthetic peptide located within the following region: EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | RSPH10B |
| Supplier Page | Shop |
Product images
WB Suggested Anti-RSPH10B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate