RTCD1 antibody

Name RTCD1 antibody
Supplier Acris Antibodies
Catalog TA345849
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat
Antigen The immunogen for Anti-Rtcd1 antibody is: synthetic peptide directed towards the middle region of Rat Rtcd1. Synthetic peptide located within the following region: QHLSGLEMVRDLCDGHLEGAEIGSTEITFTPEKIRGGVHTADTKTAGSVC.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene Rtca
Supplier Page Shop

Product images