SAMD10 antibody
| Name | SAMD10 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331674 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Guinea Pig, Human, Mouse, Rat |
| Antigen | The immunogen for Anti-SAMD10 Antibody is: synthetic peptide directed towards the N-terminal region of Human SAMD10. Synthetic peptide located within the following region: AHFSFCRTLLEHTVSAESIPCHLPRTPGTSLTWHDSRSQRAASSRPIKLL. |
| Description | Rabbit Polyclonal |
| Gene | SAMD10 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: SAMD10; Sample Tissue: 786-0 Whole Cell lysates; Antibody Dilution: 1.0ug/ml