SAPCD1 antibody
| Name | SAPCD1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332236 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Human |
| Antigen | The immunogen for Anti-SAPCD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human SAPCD1. Synthetic peptide located within the following region: NLIHEKFSPSPLNKASSCTTQDSKERRREQNLWQQQELSRQQKGVTQPKE. |
| Description | Rabbit Polyclonal |
| Gene | SAPCD1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: SAPCD1; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0ug/ml