SASH3 antibody

Name SASH3 antibody
Supplier Acris Antibodies
Catalog TA344828
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for anti-CXorf9 antibody: synthetic peptide directed towards the C terminal of human CXorf9. Synthetic peptide located within the following region: RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRET.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene SASH3
Supplier Page Shop

Product images