SAXO2 / FAM154B antibody
| Name | SAXO2 / FAM154B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA336150 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-FAM154B Antibody is: synthetic peptide directed towards the middle region of Human FAM154B. Synthetic peptide located within the following region: KPSSVVKRSTAPFNGITSHRLDYIPHQLELKFERPKEVYKPTDQRFEDLT. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SAXO2 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: FAM154B; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml