Scratch 2 (SCRT2) antibody

Name Scratch 2 (SCRT2) antibody
Supplier Acris Antibodies
Catalog TA339781
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Dog, Guinea Pig, Human, Rat, Yeast
Antigen The immunogen for anti-SCRT2 antibody: synthetic peptide directed towards the middle region of human SCRT2. Synthetic peptide located within the following region: HMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEPPPPTPAGPAS.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene SCRT2
Supplier Page Shop

Product images