Name | Scratch 2 (SCRT2) antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA339781 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Dog, Guinea Pig, Human, Rat, Yeast |
Antigen | The immunogen for anti-SCRT2 antibody: synthetic peptide directed towards the middle region of human SCRT2. Synthetic peptide located within the following region: HMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEPPPPTPAGPAS. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | SCRT2 |
Supplier Page | Shop |