SEC22C antibody

Name SEC22C antibody
Supplier Acris Antibodies
Catalog TA339638
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for anti-SEC22C antibody: synthetic peptide directed towards the middle region of human SEC22C. Synthetic peptide located within the following region: FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene SEC22C
Supplier Page Shop

Product images