SEZ6 antibody
| Name | SEZ6 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337738 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for anti-SEZ6 antibody is: synthetic peptide directed towards the C-terminal region of Human SEZ6. Synthetic peptide located within the following region: RAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQ. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SEZ6 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SEZ6 Antibody; Titration: 1.0 ug/ml; Positive Control: PANC1 Whole Cell