SF3B5 / SF3B10 antibody
| Name | SF3B5 / SF3B10 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA343080 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-Sf3b5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sf3b5. Synthetic peptide located within the following region: RDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPSGPPADKPEEN. |
| Description | Rabbit Polyclonal |
| Gene | SF3B5 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Sf3b5; Sample Tissue: Mouse Thymus lysates; Antibody Dilution: 1.0 ug/ml