Name | SHISA7 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA330840 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rat |
Antigen | The immunogen for Anti-SHISA7 antibody is: synthetic peptide directed towards the middle region of Human SHISA7. Synthetic peptide located within the following region: INVPRALVDILRHQAGPGTRPDRARSSSLTPGIGGPDSMPPRTPKNLYNT. |
Description | Rabbit Polyclonal |
Gene | SHISA7 |
Supplier Page | Shop |