SIN3B antibody
| Name | SIN3B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341814 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat |
| Antigen | The immunogen for anti-Sin3b antibody: synthetic peptide directed towards the N terminal of mouse Sin3b. Synthetic peptide located within the following region: LSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPV. |
| Description | Rabbit Polyclonal |
| Gene | Sin3b |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Sin3b Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Thymus